PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca59654.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NAC
Protein Properties Length: 342aa    MW: 38087.8 Da    PI: 9.0709
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca59654.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM153.69.1e-48161421128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                 + pGf+F+Ptde+l+ +yL++k++g ++++ + i+++di+k+ePwdLp k++ ++++ew+fFs+r kky++g++++rat+ gyWkatgk++ v+s +++
  Dca59654.1  16 MFPGFKFSPTDEQLILYYLHNKLNGFHNSV-QLISHIDICKFEPWDLPaKSIINSDHEWFFFSPRVKKYPNGSQSKRATEVGYWKATGKERCVKS-GSK 112
                 579************************999.89***************767778899*************************************9.9** PP

         NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                 l+g+k+tLvf+ grapkge+t+W+mhey +
  Dca59654.1 113 LIGTKRTLVFHIGRAPKGERTEWIMHEYCM 142
                 ****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.22E-548158IPR003441NAC domain
PROSITE profilePS5100551.53716158IPR003441NAC domain
PfamPF023654.9E-2418141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0033619Biological Processmembrane protein proteolysis
GO:0048573Biological Processphotoperiodism, flowering
GO:0071472Biological Processcellular response to salt stress
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MEMSKEAEIS IAASSMFPGF KFSPTDEQLI LYYLHNKLNG FHNSVQLISH IDICKFEPWD  60
LPAKSIINSD HEWFFFSPRV KKYPNGSQSK RATEVGYWKA TGKERCVKSG SKLIGTKRTL  120
VFHIGRAPKG ERTEWIMHEY CMAAKGQDAL VVCRVRRKCD YEKTNGSNGL ITTPNSSAMG  180
SRGTNSSCGV VPHVNNEDDL FADILNDNIV QLDECPPTTT TAGTPTLTTT ITTIPVVPHI  240
PGNASMVQPC LQGTASRRIR LRKLRRMSPR MEDLEEHTDE NEVNGPTPKS ISGASILRGP  300
MRLLVVGSRL FVFVVMTGWL LLMVSYVANP KLITFTEGRH LG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D2e-451515819168NAC domain-containing protein 19
3swp_C2e-451515819168NAC domain-containing protein 19
3swp_B2e-451515819168NAC domain-containing protein 19
3swp_A2e-451515819168NAC domain-containing protein 19
3swm_D2e-451515819168NAC domain-containing protein 19
3swm_C2e-451515819168NAC domain-containing protein 19
3swm_B2e-451515819168NAC domain-containing protein 19
3swm_A2e-451515819168NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1256262RRIRLRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00280DAPTransfer from AT2G27300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010692712.11e-110PREDICTED: NAC domain-containing protein 89-like isoform X2
SwissprotQ9XIN79e-87NAC40_ARATH; NAC domain-containing protein 40
TrEMBLA0A0K9RI701e-118A0A0K9RI70_SPIOL; Uncharacterized protein
STRINGVIT_06s0080g00970.t013e-93(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27300.16e-80NTM1-like 8